| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
| Protein Dihydroxypyridine hydroxylase DhpH [159430] (1 species) |
| Species Arthrobacter nicotinovorans [TaxId:29320] [159431] (1 PDB entry) Uniprot Q93NG3 2-163,292-394 |
| Domain d2vouc1: 2vou C:2-163,C:292-388 [153393] Other proteins in same PDB: d2voua2, d2voub2, d2vouc2 automated match to d2voua1 complexed with act, fad, gol |
PDB Entry: 2vou (more details), 2.6 Å
SCOPe Domain Sequences for d2vouc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vouc1 c.3.1.2 (C:2-163,C:292-388) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}
spttdriavvggsisgltaalmlrdagvdvdvyerspqplsgfgtgivvqpelvhylleq
gveldsisvpsssmeyvdaltgervgsvpadwrftsydsiygglyelfgperyhtskclv
glsqdsetvqmrfsdgtkaeanwvigadggasvvrkrllgieXtvdrmvhgrvlligdaa
vtprphaaaggakasddartlaevftknhdlrgslqswetrqlqqghaylnkvkkmasrl
qhggsfepgnpafafglpkv
Timeline for d2vouc1:
View in 3DDomains from other chains: (mouse over for more information) d2voua1, d2voua2, d2voub1, d2voub2 |