Lineage for d2voub2 (2vou B:164-291)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935315Family d.16.1.2: PHBH-like [54378] (4 proteins)
  6. 2935316Protein Dihydroxypyridine hydroxylase DhpH [159950] (1 species)
  7. 2935317Species Arthrobacter nicotinovorans [TaxId:29320] [159951] (1 PDB entry)
    Uniprot Q93NG3 164-201
  8. 2935319Domain d2voub2: 2vou B:164-291 [153392]
    Other proteins in same PDB: d2voua1, d2voub1, d2vouc1
    automated match to d2voua2
    complexed with act, fad, gol

Details for d2voub2

PDB Entry: 2vou (more details), 2.6 Å

PDB Description: structure of 2,6-dihydroxypyridine-3-hydroxylase from arthrobacter nicotinovorans
PDB Compounds: (B:) 2,6-dihydroxypyridine hydroxylase

SCOPe Domain Sequences for d2voub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2voub2 d.16.1.2 (B:164-291) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}
ptyagyvtwrgvlqpgevaddvwnyfndkftygllddghliaypipgrenaesprlnfqw
ywnvaegpdldelmtdvrgirlptsvhnnslnphnlrqfhskgeslfkpfrdlvlnassp
fvtvvada

SCOPe Domain Coordinates for d2voub2:

Click to download the PDB-style file with coordinates for d2voub2.
(The format of our PDB-style files is described here.)

Timeline for d2voub2: