Lineage for d2voub1 (2vou B:2-163,B:292-388)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849401Protein Dihydroxypyridine hydroxylase DhpH [159430] (1 species)
  7. 2849402Species Arthrobacter nicotinovorans [TaxId:29320] [159431] (1 PDB entry)
    Uniprot Q93NG3 2-163,292-394
  8. 2849404Domain d2voub1: 2vou B:2-163,B:292-388 [153391]
    Other proteins in same PDB: d2voua2, d2voub2, d2vouc2
    automated match to d2voua1
    complexed with act, fad, gol

Details for d2voub1

PDB Entry: 2vou (more details), 2.6 Å

PDB Description: structure of 2,6-dihydroxypyridine-3-hydroxylase from arthrobacter nicotinovorans
PDB Compounds: (B:) 2,6-dihydroxypyridine hydroxylase

SCOPe Domain Sequences for d2voub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2voub1 c.3.1.2 (B:2-163,B:292-388) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}
spttdriavvggsisgltaalmlrdagvdvdvyerspqplsgfgtgivvqpelvhylleq
gveldsisvpsssmeyvdaltgervgsvpadwrftsydsiygglyelfgperyhtskclv
glsqdsetvqmrfsdgtkaeanwvigadggasvvrkrllgieXtvdrmvhgrvlligdaa
vtprphaaaggakasddartlaevftknhdlrgslqswetrqlqqghaylnkvkkmasrl
qhggsfepgnpafafglpkv

SCOPe Domain Coordinates for d2voub1:

Click to download the PDB-style file with coordinates for d2voub1.
(The format of our PDB-style files is described here.)

Timeline for d2voub1: