SCOP 1.75: Domain d2voua2: 2vou A:164-291

Lineage for d2voua2 (2vou A:164-291)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.2: PHBH-like [54378] (4 proteins)

6. Protein Dihydroxypyridine hydroxylase DhpH [159950] (1 species)

7. Species Arthrobacter nicotinovorans [TaxId:29320] [159951] (1 PDB entry)
   Uniprot Q93NG3 164-201

8. Domain d2voua2: 2vou A:164-291 [153390]
   Other proteins in same PDB: d2voua1, d2voub1, d2vouc1
   complexed with act, fad, gol; mutant

Details for d2voua2

PDB Entry: 2vou, 2.6 Å

PDB Description: structure of 2,6-dihydroxypyridine-3-hydroxylase from arthrobacter nicotinovorans

PDB Compounds: (A:) 2,6-dihydroxypyridine hydroxylase

SCOP Domain Sequences for d2voua2:

Sequence; same for both SEQRES and ATOM records:

>d2voua2 d.16.1.2 (A:164-291) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}
ptyagyvtwrgvlqpgevaddvwnyfndkftygllddghliaypipgrenaesprlnfqw
ywnvaegpdldelmtdvrgirlptsvhnnslnphnlrqfhskgeslfkpfrdlvlnassp
fvtvvada

Timeline for d2voua2:

• d2voua2 is new in SCOP 1.75
  
• d2voua2 appears in SCOPe 2.01
  
• d2voua2 appears in the current release, SCOPe 2.08