Lineage for d2votb2 (2vot B:784-864)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1110264Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 1110265Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1110549Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species)
    truncated domain 5 lacks the last strand
  7. 1110550Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries)
    Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864
  8. 1110585Domain d2votb2: 2vot B:784-864 [153385]
    Other proteins in same PDB: d2vota4, d2vota5, d2votb4, d2votb5
    automatically matched to 2JE8 A:784-864
    complexed with br, cl, edo, nhv

Details for d2votb2

PDB Entry: 2vot (more details), 1.95 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2votb2:

Sequence, based on SEQRES records: (download)

>d2votb2 b.1.4.1 (B:784-864) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits
prikkgeelpvnikhiretyk

Sequence, based on observed residues (ATOM records): (download)

>d2votb2 b.1.4.1 (B:784-864) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits
prikkgelpvnikhiretyk

SCOPe Domain Coordinates for d2votb2:

Click to download the PDB-style file with coordinates for d2votb2.
(The format of our PDB-style files is described here.)

Timeline for d2votb2: