![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries) |
![]() | Domain d2votb2: 2vot B:784-864 [153385] Other proteins in same PDB: d2vota4, d2vota5, d2votb4, d2votb5, d2votb6 automated match to d2je8a2 complexed with br, cl, edo, nhv |
PDB Entry: 2vot (more details), 1.95 Å
SCOPe Domain Sequences for d2votb2:
Sequence, based on SEQRES records: (download)
>d2votb2 b.1.4.0 (B:784-864) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits prikkgeelpvnikhiretyk
>d2votb2 b.1.4.0 (B:784-864) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits prikkgelpvnikhiretyk
Timeline for d2votb2: