![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species) truncated domain 5 lacks the last strand |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries) Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864 |
![]() | Domain d2votb1: 2vot B:220-330 [153384] Other proteins in same PDB: d2vota4, d2vota5, d2votb4, d2votb5 automatically matched to 2JE8 A:220-330 complexed with br, cl, edo, nhv |
PDB Entry: 2vot (more details), 1.95 Å
SCOPe Domain Sequences for d2votb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2votb1 b.1.4.1 (B:220-330) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]} iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl
Timeline for d2votb1: