| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries) |
| Domain d2votb1: 2vot B:220-330 [153384] Other proteins in same PDB: d2vota4, d2vota5, d2votb4, d2votb5, d2votb6 automated match to d2je8a1 complexed with br, cl, edo, nhv |
PDB Entry: 2vot (more details), 1.95 Å
SCOPe Domain Sequences for d2votb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2votb1 b.1.4.0 (B:220-330) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq
pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl
Timeline for d2votb1: