| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
| Family c.1.8.3: beta-glycanases [51487] (26 proteins) consist of a number of sequence families |
| Protein Five-domain beta-mannosidase, domain 3 [159385] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [159386] (9 PDB entries) Uniprot Q8AAK6 330-678! Uniprot Q8AAK6 331-678 |
| Domain d2vota5: 2vot A:331-678 [153383] Other proteins in same PDB: d2vota1, d2vota2, d2vota3, d2vota4, d2votb1, d2votb2, d2votb3, d2votb4 automatically matched to 2JE8 A:331-678 complexed with br, cl, edo, nhv |
PDB Entry: 2vot (more details), 1.95 Å
SCOP Domain Sequences for d2vota5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vota5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]}
rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn
mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn
haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv
hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf
aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle
ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2vota5: