Lineage for d2vota1 (2vot A:220-330)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787894Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 787895Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 788179Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species)
    truncated domain 5 lacks the last strand
  7. 788180Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries)
    Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864
  8. 788205Domain d2vota1: 2vot A:220-330 [153379]
    Other proteins in same PDB: d2vota4, d2vota5, d2votb4, d2votb5
    automatically matched to 2JE8 A:220-330
    complexed with br, cl, edo, nhv

Details for d2vota1

PDB Entry: 2vot (more details), 1.95 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOP Domain Sequences for d2vota1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vota1 b.1.4.1 (A:220-330) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq
pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl

SCOP Domain Coordinates for d2vota1:

Click to download the PDB-style file with coordinates for d2vota1.
(The format of our PDB-style files is described here.)

Timeline for d2vota1: