| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.46: La domain [101051] (2 proteins) Pfam PF05383; RNA-binding domain |
| Protein Lupus La autoantigen N-terminal domain [101052] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101053] (7 PDB entries) |
| Domain d2vopa1: 2vop A:8-103 [153377] Other proteins in same PDB: d2vopa2 automatically matched to d1s7aa_ protein/RNA complex; complexed with so4 |
PDB Entry: 2vop (more details), 2.8 Å
SCOPe Domain Sequences for d2vopa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vopa1 a.4.5.46 (A:8-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdfnv
ivealskskaelmeisedktkirrspskplpevtde
Timeline for d2vopa1: