Lineage for d2vooa2 (2voo A:105-188)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908527Protein Lupus LA protein [89940] (1 species)
  7. 1908528Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)
  8. 1908531Domain d2vooa2: 2voo A:105-188 [153374]
    Other proteins in same PDB: d2vooa1, d2voob1
    automatically matched to d1s79a_
    protein/RNA complex

Details for d2vooa2

PDB Entry: 2voo (more details), 1.8 Å

PDB Description: crystal structure of n-terminal domains of human la protein complexed with rna oligomer uuuuuuuu
PDB Compounds: (A:) Lupus La protein

SCOPe Domain Sequences for d2vooa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vooa2 d.58.7.1 (A:105-188) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
kndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesa
kkfvetpgqkyketdllilfkddy

SCOPe Domain Coordinates for d2vooa2:

Click to download the PDB-style file with coordinates for d2vooa2.
(The format of our PDB-style files is described here.)

Timeline for d2vooa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vooa1