![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Lupus LA protein [89940] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries) |
![]() | Domain d2vonb2: 2von B:105-192 [153372] Other proteins in same PDB: d2vona1, d2vonb1 automatically matched to d1s79a_ protein/RNA complex |
PDB Entry: 2von (more details), 2.1 Å
SCOPe Domain Sequences for d2vonb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vonb2 d.58.7.1 (B:105-192) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} kndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesa kkfvetpgqkyketdllilfkddyfakk
Timeline for d2vonb2: