SCOPe 2.06: Domain d2vodb1: 2vod B:6-103

Lineage for d2vodb1 (2vod B:6-103)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.46: La domain [101051] (2 proteins)
   Pfam PF05383; RNA-binding domain

6. Protein Lupus La autoantigen N-terminal domain [101052] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101053] (7 PDB entries)

8. Domain d2vodb1: 2vod B:6-103 [153367]
   Other proteins in same PDB: d2voda2, d2vodb2
   automatically matched to d1s7aa_
   protein/RNA complex

Details for d2vodb1

PDB Entry: 2vod, 2.1 Å

PDB Description: crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu

PDB Compounds: (B:) Lupus La protein

SCOPe Domain Sequences for d2vodb1:

Sequence; same for both SEQRES and ATOM records:

>d2vodb1 a.4.5.46 (B:6-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdf
nvivealskskaelmeisedktkirrspskplpevtde

Timeline for d2vodb1:

• d2vodb1 first appeared in SCOP 1.75
  
• d2vodb1 appears in SCOPe 2.05
  
• d2vodb1 appears in SCOPe 2.07
  
• d2vodb1 appears in the current release, SCOPe 2.08