Lineage for d2voda2 (2vod A:105-192)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862050Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) (S)
  5. 862051Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 862137Protein Lupus LA protein [89940] (1 species)
  7. 862138Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)
  8. 862143Domain d2voda2: 2vod A:105-192 [153366]
    Other proteins in same PDB: d2voda1, d2vodb1
    automatically matched to d1s79a_

Details for d2voda2

PDB Entry: 2vod (more details), 2.1 Å

PDB Description: crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu
PDB Compounds: (A:) Lupus La protein

SCOP Domain Sequences for d2voda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2voda2 d.58.7.1 (A:105-192) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
kndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesa
kkfvetpgqkyketdllilfkddyfakk

SCOP Domain Coordinates for d2voda2:

Click to download the PDB-style file with coordinates for d2voda2.
(The format of our PDB-style files is described here.)

Timeline for d2voda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2voda1