Lineage for d2vo9c2 (2vo9 C:1-148)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956780Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2956781Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2956851Family d.65.1.5: VanY-like [160436] (2 proteins)
    Pfam PF02557
  6. 2956857Protein automated matches [190906] (1 species)
    not a true protein
  7. 2956858Species Bacteriophage a500 [TaxId:40522] [188351] (1 PDB entry)
  8. 2956860Domain d2vo9c2: 2vo9 C:1-148 [153364]
    Other proteins in same PDB: d2vo9a1, d2vo9a2, d2vo9b3, d2vo9c3
    automated match to d2vo9a1
    complexed with so4, zn

Details for d2vo9c2

PDB Entry: 2vo9 (more details), 1.8 Å

PDB Description: crystal structure of the enzymatically active domain of the listeria monocytogenes bacteriophage 500 endolysin ply500
PDB Compounds: (C:) l-alanyl-d-glutamate peptidase

SCOPe Domain Sequences for d2vo9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vo9c2 d.65.1.5 (C:1-148) automated matches {Bacteriophage a500 [TaxId: 40522]}
malteawliekanrklnaggmykitsdktrnvikkmakegiylcvaqgyrstaeqnalya
qgrtkpgaivtnakggqsnhnygvavdlclytndgkdviwesttsrwkkvvaamkaegfk
wggdwksfkdyphfelcdavsgekipaa

SCOPe Domain Coordinates for d2vo9c2:

Click to download the PDB-style file with coordinates for d2vo9c2.
(The format of our PDB-style files is described here.)

Timeline for d2vo9c2: