Lineage for d2vo9a1 (2vo9 A:1-148)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563508Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2563509Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2563579Family d.65.1.5: VanY-like [160436] (2 proteins)
    Pfam PF02557
  6. 2563580Protein L-alanyl-D-glutamate peptidase Ply [160437] (1 species)
  7. 2563581Species Listeria phage A500 [TaxId:40522] [160438] (2 PDB entries)
    Uniprot Q37979 1-148
  8. 2563584Domain d2vo9a1: 2vo9 A:1-148 [153362]
    Other proteins in same PDB: d2vo9a2, d2vo9b2, d2vo9b3, d2vo9c2, d2vo9c3
    complexed with so4, zn

Details for d2vo9a1

PDB Entry: 2vo9 (more details), 1.8 Å

PDB Description: crystal structure of the enzymatically active domain of the listeria monocytogenes bacteriophage 500 endolysin ply500
PDB Compounds: (A:) l-alanyl-d-glutamate peptidase

SCOPe Domain Sequences for d2vo9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vo9a1 d.65.1.5 (A:1-148) L-alanyl-D-glutamate peptidase Ply {Listeria phage A500 [TaxId: 40522]}
malteawliekanrklnaggmykitsdktrnvikkmakegiylcvaqgyrstaeqnalya
qgrtkpgaivtnakggqsnhnygvavdlclytndgkdviwesttsrwkkvvaamkaegfk
wggdwksfkdyphfelcdavsgekipaa

SCOPe Domain Coordinates for d2vo9a1:

Click to download the PDB-style file with coordinates for d2vo9a1.
(The format of our PDB-style files is described here.)

Timeline for d2vo9a1: