Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein Exo-alpha-sialidase [158920] (1 species) pre C-terminal domain |
Species Clostridium perfringens [TaxId:1502] [158921] (1 PDB entry) Uniprot Q0TTQ4 945-1080 |
Domain d2vo8a1: 2vo8 A:939-1074 [153361] |
PDB Entry: 2vo8 (more details), 1.7 Å
SCOPe Domain Sequences for d2vo8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vo8a1 b.2.2.2 (A:939-1074) Exo-alpha-sialidase {Clostridium perfringens [TaxId: 1502]} ttvgnstikvndevqvgsafeailgieglngdtevysaeylfeynaeafilneitsfnds lfvkskevepgkvrilvaslgneiekdsdlvkvnltpkisselevlglttalvgagdgnt hdlelsskevkineea
Timeline for d2vo8a1: