SCOPe 2.01: Domain d2vo8a1: 2vo8 A:939-1074

Lineage for d2vo8a1 (2vo8 A:939-1074)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Exo-alpha-sialidase [158920] (1 species)
   pre C-terminal domain

7. Species Clostridium perfringens [TaxId:1502] [158921] (1 PDB entry)
   Uniprot Q0TTQ4 945-1080

8. Domain d2vo8a1: 2vo8 A:939-1074 [153361]

Details for d2vo8a1

PDB Entry: 2vo8, 1.7 Å

PDB Description: cohesin module from clostridium perfringens atcc13124 family 33 glycoside hydrolase.

PDB Compounds: (A:) exo-alpha-sialidase

SCOPe Domain Sequences for d2vo8a1:

Sequence; same for both SEQRES and ATOM records:

>d2vo8a1 b.2.2.2 (A:939-1074) Exo-alpha-sialidase {Clostridium perfringens [TaxId: 1502]}
ttvgnstikvndevqvgsafeailgieglngdtevysaeylfeynaeafilneitsfnds
lfvkskevepgkvrilvaslgneiekdsdlvkvnltpkisselevlglttalvgagdgnt
hdlelsskevkineea

Timeline for d2vo8a1:

• d2vo8a1 first appeared in SCOP 1.75
  
• d2vo8a1 appears in SCOPe 2.02
  
• d2vo8a1 appears in the current release, SCOPe 2.08