| Class b: All beta proteins [48724] (178 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (49 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries) |
| Domain d2vo5a4: 2vo5 A:28-219 [153353] Other proteins in same PDB: d2vo5a1, d2vo5a2, d2vo5a3, d2vo5a5, d2vo5b1, d2vo5b2, d2vo5b3, d2vo5b5, d2vo5b6 automated match to d2je8a4 complexed with br, cl, edo, vbz |
PDB Entry: 2vo5 (more details), 2.3 Å
SCOPe Domain Sequences for d2vo5a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vo5a4 b.18.1.0 (A:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd
Timeline for d2vo5a4: