| Class b: All beta proteins [48724] (174 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein Beta-mannosidase [158959] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (9 PDB entries) Uniprot Q8AAK6 28-219 |
| Domain d2vo5a4: 2vo5 A:28-219 [153353] Other proteins in same PDB: d2vo5a1, d2vo5a2, d2vo5a3, d2vo5a5, d2vo5b1, d2vo5b2, d2vo5b3, d2vo5b5 automatically matched to 2JE8 A:28-219 complexed with br, cl, edo, vbz |
PDB Entry: 2vo5 (more details), 2.3 Å
SCOP Domain Sequences for d2vo5a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vo5a4 b.18.1.5 (A:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd
Timeline for d2vo5a4: