![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries) |
![]() | Domain d2vo5a3: 2vo5 A:679-783 [153352] Other proteins in same PDB: d2vo5a4, d2vo5a5, d2vo5b4, d2vo5b5, d2vo5b6 automated match to d2je8a3 complexed with br, cl, edo, vbz |
PDB Entry: 2vo5 (more details), 2.3 Å
SCOPe Domain Sequences for d2vo5a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vo5a3 b.1.4.0 (A:679-783) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq
Timeline for d2vo5a3: