Lineage for d2vo1a1 (2vo1 A:1-273)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869097Protein CTP synthase PyrG, N-terminal domain [110551] (3 species)
  7. 2869101Species Human (Homo sapiens) [TaxId:9606] [159561] (1 PDB entry)
    Uniprot Q5VW67 1-273
  8. 2869102Domain d2vo1a1: 2vo1 A:1-273 [153348]
    Other proteins in same PDB: d2vo1a2, d2vo1b3
    complexed with so4

Details for d2vo1a1

PDB Entry: 2vo1 (more details), 2.8 Å

PDB Description: crystal structure of the synthetase domain of human ctp synthetase
PDB Compounds: (A:) ctp synthase 1

SCOPe Domain Sequences for d2vo1a1:

Sequence, based on SEQRES records: (download)

>d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mkyilvtggvisgigkgiiassvgtilkscglhvtsikidpyinidagtfspyehgevfv
lddggevdldlgnyerfldirltkdnnlttgkiyqyvinkerkgdylgktvqvvphitda
iqewvmrqalipvdedglepqvcvielggtvgdiesmpfieafrqfqfkvkrenfcnihv
slvpqpsstgeqktkptqnsvrelrglglspdlvvcrcsnpldtsvkekismfchvepeq
vicvhdvssiyrvpllleeqgvvdyflrrldlp

Sequence, based on observed residues (ATOM records): (download)

>d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mkyilvtggvisgigkgiiassvgtilkscglhvtsikidpyinidnnlttgkiyqyvin
kerkgdylgktvqvvphitdaiqewvmrqalipvdedglepqvcvielggtvgdiesmpf
ieafrqfqfkvkrenfcnihvslvpqpssgeqktkptqnsvrelrglglspdlvvcrcsn
pldtsvkekismfchvepeqvicvhdvssiyrvpllleeqgvvdyflrrldlp

SCOPe Domain Coordinates for d2vo1a1:

Click to download the PDB-style file with coordinates for d2vo1a1.
(The format of our PDB-style files is described here.)

Timeline for d2vo1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vo1a2