Lineage for d2vnud4 (2vnu D:495-910)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052173Family b.40.4.16: RNB domain-like [159112] (3 protein domains)
    Pfam PF00773; RNase II catalytic domain; decorated OB-fold domain with extra C-terminal structures forming the active site
  6. 2052182Protein Exosome complex exonuclease RRP44 [159113] (1 species)
  7. 2052183Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159114] (1 PDB entry)
    Uniprot Q08162 495-910
  8. 2052184Domain d2vnud4: 2vnu D:495-910 [153347]
    Other proteins in same PDB: d2vnud1, d2vnud2, d2vnud3
    protein/RNA complex; complexed with 1pe, mg, na

Details for d2vnud4

PDB Entry: 2vnu (more details), 2.3 Å

PDB Description: crystal structure of sc rrp44
PDB Compounds: (D:) exosome complex exonuclease rrp44

SCOPe Domain Sequences for d2vnud4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnud4 b.40.4.16 (D:495-910) Exosome complex exonuclease RRP44 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fskkvleclpaeghdwkaptklddpeavskdplltkrkdlrdklicsidppgcvdindal
hakklpngnwevgvhiadvthfvkpgtaldaegaargtsvylvdkridmlpmllgtdlcs
lkpyvdrfafsviwelddsanivnvnfmksvirsreafsyeqaqlriddktqndeltmgm
rallklsvklkqkrleagalnlaspevkvhmdsetsdpneveikkllatnslveefmlla
nisvarkiydafpqtamlrrhaappstnfeilnemlntrknmsislesskaladsldrcv
dpedpyfntlvrimstrcmmaaqyfysgaysypdfrhyglavdiythftspirrycdvva
hrqlagaigyeplslthrdknkmdmicrninrkhrnaqfagrasieyyvgqvmrnn

SCOPe Domain Coordinates for d2vnud4:

Click to download the PDB-style file with coordinates for d2vnud4.
(The format of our PDB-style files is described here.)

Timeline for d2vnud4: