Lineage for d2vnra_ (2vnr A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942707Family b.18.1.33: NPCBM-like [158966] (3 proteins)
    Pfam PF08305
  6. 942714Protein automated matches [190905] (1 species)
    not a true protein
  7. 942715Species Clostridium perfringens [TaxId:1502] [188350] (5 PDB entries)
  8. 942720Domain d2vnra_: 2vnr A: [153343]
    automated match to d2vnga1
    complexed with ca

Details for d2vnra_

PDB Entry: 2vnr (more details), 1.55 Å

PDB Description: family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens.
PDB Compounds: (A:) cpe0329

SCOPe Domain Sequences for d2vnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnra_ b.18.1.33 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
srdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsisefekglgt
iagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviystinqfp
ngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdfvn

SCOPe Domain Coordinates for d2vnra_:

Click to download the PDB-style file with coordinates for d2vnra_.
(The format of our PDB-style files is described here.)

Timeline for d2vnra_: