SCOP 1.75: Domain d2vnra1: 2vnr A:39-209

Lineage for d2vnra1 (2vnr A:39-209)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families)

5. Family b.18.1.33: NPCBM-like [158966] (2 proteins)
   Pfam PF08305

6. Protein Uncharacterized protein CPE0329 [158969] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [158970] (3 PDB entries)
   Uniprot Q8XNK4 34-204

8. Domain d2vnra1: 2vnr A:39-209 [153343]
   automatically matched to 2VNG A:39-209
   complexed with ca

Details for d2vnra1

PDB Entry: 2vnr, 1.55 Å

PDB Description: family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens.

PDB Compounds: (A:) cpe0329

SCOP Domain Sequences for d2vnra1:

Sequence; same for both SEQRES and ATOM records:

>d2vnra1 b.18.1.33 (A:39-209) Uncharacterized protein CPE0329 {Clostridium perfringens [TaxId: 1502]}
srdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsisefekglgt
iagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviystinqfp
ngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdf

Timeline for d2vnra1:

• d2vnra1 is new in SCOP 1.75
  
• d2vnra1 is called d2vnra_ in SCOPe 2.01
  
• d2vnra1 appears in the current release, SCOPe 2.08, called d2vnra_