SCOP 1.75: Domain d2vnqa1: 2vnq A:4-179

Lineage for d2vnqa1 (2vnq A:4-179)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (7 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (3 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
   Uniprot Q46822

8. Domain d2vnqa1: 2vnq A:4-179 [153341]
   automatically matched to d1nfsb_
   complexed with imd, mn, so4

Details for d2vnqa1

PDB Entry: 2vnq, 2.2 Å

PDB Description: monoclinic form of idi-1

PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOP Domain Sequences for d2vnqa1:

Sequence; same for both SEQRES and ATOM records:

>d2vnqa1 d.113.1.2 (A:4-179) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

Timeline for d2vnqa1:

• d2vnqa1 is new in SCOP 1.75
  
• d2vnqa1 is called d2vnqa_ in SCOPe 2.01
  
• d2vnqa1 appears in the current release, SCOPe 2.08, called d2vnqa_