SCOPe 2.05: Domain d2vnob_: 2vno B:

Lineage for d2vnob_ (2vno B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.33: NPCBM-like [158966] (3 proteins)
   Pfam PF08305

6. Protein automated matches [190905] (1 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [188350] (5 PDB entries)

8. Domain d2vnob_: 2vno B: [153338]
   automated match to d2vnga1
   complexed with ca, gal

Details for d2vnob_

PDB Entry: 2vno, 1.45 Å

PDB Description: family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens in complex with blood group b-trisaccharide ligand.

PDB Compounds: (B:) cpe0329

SCOPe Domain Sequences for d2vnob_:

Sequence; same for both SEQRES and ATOM records:

>d2vnob_ b.18.1.33 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
esrdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsisefekglg
tiagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviystinqf
pngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdfv

Timeline for d2vnob_:

• d2vnob_ first appeared in SCOP 1.75, called d2vnob1
  
• d2vnob_ appears in SCOPe 2.04
  
• d2vnob_ appears in SCOPe 2.06
  
• d2vnob_ appears in the current release, SCOPe 2.08