Lineage for d2vnob_ (2vno B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370384Family b.18.1.33: NPCBM-like [158966] (3 protein domains)
    Pfam PF08305
  6. 2370391Protein automated matches [190905] (1 species)
    not a true protein
  7. 2370392Species Clostridium perfringens [TaxId:1502] [188350] (5 PDB entries)
  8. 2370397Domain d2vnob_: 2vno B: [153338]
    automated match to d2vnga1
    complexed with ca, fuc, gal

Details for d2vnob_

PDB Entry: 2vno (more details), 1.45 Å

PDB Description: family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens in complex with blood group b-trisaccharide ligand.
PDB Compounds: (B:) cpe0329

SCOPe Domain Sequences for d2vnob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnob_ b.18.1.33 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
esrdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsisefekglg
tiagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviystinqf
pngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdfv

SCOPe Domain Coordinates for d2vnob_:

Click to download the PDB-style file with coordinates for d2vnob_.
(The format of our PDB-style files is described here.)

Timeline for d2vnob_: