Lineage for d2vnoa_ (2vno A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530937Family b.18.1.33: NPCBM-like [158966] (3 proteins)
    Pfam PF08305
  6. 1530944Protein automated matches [190905] (1 species)
    not a true protein
  7. 1530945Species Clostridium perfringens [TaxId:1502] [188350] (5 PDB entries)
  8. 1530948Domain d2vnoa_: 2vno A: [153337]
    automated match to d2vnga1
    complexed with ca, gal

Details for d2vnoa_

PDB Entry: 2vno (more details), 1.45 Å

PDB Description: family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens in complex with blood group b-trisaccharide ligand.
PDB Compounds: (A:) cpe0329

SCOPe Domain Sequences for d2vnoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnoa_ b.18.1.33 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
srdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsisefekglgt
iagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviystinqfp
ngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdf

SCOPe Domain Coordinates for d2vnoa_:

Click to download the PDB-style file with coordinates for d2vnoa_.
(The format of our PDB-style files is described here.)

Timeline for d2vnoa_: