Lineage for d2vnoa1 (2vno A:39-209)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 793335Family b.18.1.33: NPCBM-like [158966] (2 proteins)
    Pfam PF08305
  6. 793336Protein Uncharacterized protein CPE0329 [158969] (1 species)
  7. 793337Species Clostridium perfringens [TaxId:1502] [158970] (3 PDB entries)
    Uniprot Q8XNK4 34-204
  8. 793340Domain d2vnoa1: 2vno A:39-209 [153337]
    automatically matched to 2VNG A:39-209
    complexed with ca, fuc, gal

Details for d2vnoa1

PDB Entry: 2vno (more details), 1.45 Å

PDB Description: family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens in complex with blood group b-trisaccharide ligand.
PDB Compounds: (A:) cpe0329

SCOP Domain Sequences for d2vnoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnoa1 b.18.1.33 (A:39-209) Uncharacterized protein CPE0329 {Clostridium perfringens [TaxId: 1502]}
srdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsisefekglgt
iagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviystinqfp
ngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdf

SCOP Domain Coordinates for d2vnoa1:

Click to download the PDB-style file with coordinates for d2vnoa1.
(The format of our PDB-style files is described here.)

Timeline for d2vnoa1: