Lineage for d2vngb_ (2vng B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774922Family b.18.1.33: NPCBM-like [158966] (3 proteins)
    Pfam PF08305
  6. 2774929Protein automated matches [190905] (1 species)
    not a true protein
  7. 2774930Species Clostridium perfringens [TaxId:1502] [188350] (5 PDB entries)
  8. 2774932Domain d2vngb_: 2vng B: [153336]
    Other proteins in same PDB: d2vnga1
    automated match to d2vnga1
    complexed with ca

Details for d2vngb_

PDB Entry: 2vng (more details), 1.4 Å

PDB Description: family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens in complex with blood group a-trisaccharide ligand.
PDB Compounds: (B:) cpe0329

SCOPe Domain Sequences for d2vngb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vngb_ b.18.1.33 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
esrdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsisefekglg
tiagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviystinqf
pngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdfv

SCOPe Domain Coordinates for d2vngb_:

Click to download the PDB-style file with coordinates for d2vngb_.
(The format of our PDB-style files is described here.)

Timeline for d2vngb_: