Lineage for d2vnga1 (2vng A:39-209)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384604Family b.18.1.33: NPCBM-like [158966] (3 proteins)
    Pfam PF08305
  6. 2384605Protein Uncharacterized protein CPE0329 [158969] (1 species)
  7. 2384606Species Clostridium perfringens [TaxId:1502] [158970] (1 PDB entry)
    Uniprot Q8XNK4 34-204
  8. 2384607Domain d2vnga1: 2vng A:39-209 [153335]
    Other proteins in same PDB: d2vngb_
    complexed with a2g, ca, fuc, gal

Details for d2vnga1

PDB Entry: 2vng (more details), 1.4 Å

PDB Description: family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens in complex with blood group a-trisaccharide ligand.
PDB Compounds: (A:) cpe0329

SCOPe Domain Sequences for d2vnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnga1 b.18.1.33 (A:39-209) Uncharacterized protein CPE0329 {Clostridium perfringens [TaxId: 1502]}
srdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsisefekglgt
iagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviystinqfp
ngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdf

SCOPe Domain Coordinates for d2vnga1:

Click to download the PDB-style file with coordinates for d2vnga1.
(The format of our PDB-style files is described here.)

Timeline for d2vnga1: