Lineage for d2vnfc1 (2vnf C:191-244)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067163Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1067164Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1067187Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 1067191Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species)
  7. 1067192Species Human (Homo sapiens) [TaxId:9606] [161223] (3 PDB entries)
  8. 1067194Domain d2vnfc1: 2vnf C:191-244 [153334]
    automatically matched to d1wena_
    complexed with dtt, dtu, na, zn

Details for d2vnfc1

PDB Entry: 2vnf (more details), 1.76 Å

PDB Description: molecular basis of histone h3k4me3 recognition by ing4
PDB Compounds: (C:) Inhibitor of growth protein 4

SCOPe Domain Sequences for d2vnfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnfc1 g.50.1.2 (C:191-244) Inhibitor of growth protein 4, Ing4 {Human (Homo sapiens) [TaxId: 9606]}
vdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq

SCOPe Domain Coordinates for d2vnfc1:

Click to download the PDB-style file with coordinates for d2vnfc1.
(The format of our PDB-style files is described here.)

Timeline for d2vnfc1: