Lineage for d2vnfc_ (2vnf C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037886Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 3037935Protein automated matches [190654] (2 species)
    not a true protein
  7. 3037936Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries)
  8. 3037939Domain d2vnfc_: 2vnf C: [153334]
    automated match to d1wena_
    complexed with dtt, dtu, na, zn

Details for d2vnfc_

PDB Entry: 2vnf (more details), 1.76 Å

PDB Description: molecular basis of histone h3k4me3 recognition by ing4
PDB Compounds: (C:) Inhibitor of growth protein 4

SCOPe Domain Sequences for d2vnfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnfc_ g.50.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq

SCOPe Domain Coordinates for d2vnfc_:

Click to download the PDB-style file with coordinates for d2vnfc_.
(The format of our PDB-style files is described here.)

Timeline for d2vnfc_: