Lineage for d2vnfa_ (2vnf A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642549Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2642550Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2642573Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2642622Protein automated matches [190654] (2 species)
    not a true protein
  7. 2642623Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries)
  8. 2642625Domain d2vnfa_: 2vnf A: [153333]
    automated match to d1wena_
    complexed with dtt, dtu, na, zn

Details for d2vnfa_

PDB Entry: 2vnf (more details), 1.76 Å

PDB Description: molecular basis of histone h3k4me3 recognition by ing4
PDB Compounds: (A:) Inhibitor of growth protein 4

SCOPe Domain Sequences for d2vnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnfa_ g.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq

SCOPe Domain Coordinates for d2vnfa_:

Click to download the PDB-style file with coordinates for d2vnfa_.
(The format of our PDB-style files is described here.)

Timeline for d2vnfa_: