![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
![]() | Protein Cohesin domain [49396] (2 species) |
![]() | Species Clostridium cellulolyticum [TaxId:1521] [158919] (2 PDB entries) |
![]() | Domain d2vn6a_: 2vn6 A: [153332] Other proteins in same PDB: d2vn6b_ automated match to d1g1ka_ complexed with ca |
PDB Entry: 2vn6 (more details), 1.49 Å
SCOPe Domain Sequences for d2vn6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vn6a_ b.2.2.2 (A:) Cohesin domain {Clostridium cellulolyticum [TaxId: 1521]} tvlpkdipgdslkvtvgtangkpgdtvtvpvtfadvakmknvgtcnfylgydasllevvs vdagpivknaavnfsssasngtisflfldntitdelitadgvfanikfklksvtaktttp vtfkdggafgdgtmskiasvtktngsvtidp
Timeline for d2vn6a_: