Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.33: NPCBM-like [158966] (3 proteins) Pfam PF08305 |
Protein automated matches [190905] (1 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [188350] (5 PDB entries) |
Domain d2vmia_: 2vmi A: [153328] automated match to d2vmga1 complexed with ca |
PDB Entry: 2vmi (more details), 1.7 Å
SCOPe Domain Sequences for d2vmia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vmia_ b.18.1.33 (A:) automated matches {Clostridium perfringens [TaxId: 1502]} etsvylselewksastgygeiqkdascdgntitlkgengekvsydkgigthahseivysl egldyydyfetfvgvdqemagtvasisfevyldnekvfdsglmtgdttqkhvkvpiagkn tlklvvkdggdsigsdhgsfgdaklt
Timeline for d2vmia_: