Lineage for d2vmha_ (2vmh A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2047073Family b.18.1.33: NPCBM-like [158966] (3 proteins)
    Pfam PF08305
  6. 2047080Protein automated matches [190905] (1 species)
    not a true protein
  7. 2047081Species Clostridium perfringens [TaxId:1502] [188350] (5 PDB entries)
  8. 2047083Domain d2vmha_: 2vmh A: [153327]
    automated match to d2vmga1
    complexed with ca

Details for d2vmha_

PDB Entry: 2vmh (more details), 1.5 Å

PDB Description: the structure of cbm51 from clostridium perfringens gh95
PDB Compounds: (A:) fibronectin type III domain protein

SCOPe Domain Sequences for d2vmha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vmha_ b.18.1.33 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
vetsvylselewksastgygeiqkdascdgntitlkgengekvsydkgigthahseivys
legldyydyfetfvgvdqemagtvasisfevyldnekvfdsglmtgdttqkhvkvpiagk
ntlklvvkdggdsigsdhgsfgdaklt

SCOPe Domain Coordinates for d2vmha_:

Click to download the PDB-style file with coordinates for d2vmha_.
(The format of our PDB-style files is described here.)

Timeline for d2vmha_: