Lineage for d2vmha1 (2vmh A:906-1050)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 793335Family b.18.1.33: NPCBM-like [158966] (2 proteins)
    Pfam PF08305
  6. 793343Protein Uncharacterized Protein CPF2129 [158967] (1 species)
  7. 793344Species Clostridium perfringens [TaxId:1502] [158968] (3 PDB entries)
    Uniprot Q0TP83 906-1050
  8. 793345Domain d2vmha1: 2vmh A:906-1050 [153327]
    automatically matched to 2VMG A:33-177
    complexed with ca

Details for d2vmha1

PDB Entry: 2vmh (more details), 1.5 Å

PDB Description: the structure of cbm51 from clostridium perfringens gh95
PDB Compounds: (A:) fibronectin type III domain protein

SCOP Domain Sequences for d2vmha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vmha1 b.18.1.33 (A:906-1050) Uncharacterized Protein CPF2129 {Clostridium perfringens [TaxId: 1502]}
tsvylselewksastgygeiqkdascdgntitlkgengekvsydkgigthahseivysle
gldyydyfetfvgvdqemagtvasisfevyldnekvfdsglmtgdttqkhvkvpiagknt
lklvvkdggdsigsdhgsfgdaklt

SCOP Domain Coordinates for d2vmha1:

Click to download the PDB-style file with coordinates for d2vmha1.
(The format of our PDB-style files is described here.)

Timeline for d2vmha1: