![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein automated matches [190057] (21 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [255614] (7 PDB entries) |
![]() | Domain d2vmfb5: 2vmf B:331-678 [153325] Other proteins in same PDB: d2vmfa1, d2vmfa2, d2vmfa3, d2vmfa4, d2vmfb1, d2vmfb2, d2vmfb3, d2vmfb4 automated match to d2je8a5 complexed with br, cl, edo, mvl |
PDB Entry: 2vmf (more details), 2.1 Å
SCOPe Domain Sequences for d2vmfb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vmfb5 c.1.8.3 (B:331-678) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2vmfb5: