![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (37 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries) |
![]() | Domain d2vmfb4: 2vmf B:27-219 [153324] Other proteins in same PDB: d2vmfa1, d2vmfa2, d2vmfa3, d2vmfa5, d2vmfb1, d2vmfb2, d2vmfb3, d2vmfb5, d2vmfb6 automated match to d2je8a4 complexed with br, cl, edo, mvl |
PDB Entry: 2vmf (more details), 2.1 Å
SCOPe Domain Sequences for d2vmfb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vmfb4 b.18.1.0 (B:27-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} gndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwven edweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlr kgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvt sgvwrpvtlrfyd
Timeline for d2vmfb4: