Lineage for d2vmfb3 (2vmf B:679-783)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787894Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 787895Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 788179Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species)
    truncated domain 5 lacks the last strand
  7. 788180Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries)
    Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864
  8. 788222Domain d2vmfb3: 2vmf B:679-783 [153323]
    Other proteins in same PDB: d2vmfa4, d2vmfa5, d2vmfb4, d2vmfb5
    automatically matched to 2JE8 A:679-783
    complexed with br, cl, edo, mvl

Details for d2vmfb3

PDB Entry: 2vmf (more details), 2.1 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOP Domain Sequences for d2vmfb3:

Sequence, based on SEQRES records: (download)

>d2vmfb3 b.1.4.1 (B:679-783) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv
yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq

Sequence, based on observed residues (ATOM records): (download)

>d2vmfb3 b.1.4.1 (B:679-783) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv
yrakldgwltpedcrrsflklilkdsghqvaesvhffrktkdlq

SCOP Domain Coordinates for d2vmfb3:

Click to download the PDB-style file with coordinates for d2vmfb3.
(The format of our PDB-style files is described here.)

Timeline for d2vmfb3: