Lineage for d2vmfb3 (2vmf B:679-783)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2762955Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries)
  8. 2762997Domain d2vmfb3: 2vmf B:679-783 [153323]
    Other proteins in same PDB: d2vmfa4, d2vmfa5, d2vmfb4, d2vmfb5, d2vmfb6
    automated match to d2je8a3
    complexed with br, cl, edo, mvl

Details for d2vmfb3

PDB Entry: 2vmf (more details), 2.1 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vmfb3:

Sequence, based on SEQRES records: (download)

>d2vmfb3 b.1.4.0 (B:679-783) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv
yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq

Sequence, based on observed residues (ATOM records): (download)

>d2vmfb3 b.1.4.0 (B:679-783) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv
yrakldgwltpedcrrsflklilkdsghqvaesvhffrktkdlq

SCOPe Domain Coordinates for d2vmfb3:

Click to download the PDB-style file with coordinates for d2vmfb3.
(The format of our PDB-style files is described here.)

Timeline for d2vmfb3: