Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (19 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries) |
Domain d2vmfb2: 2vmf B:784-864 [153322] Other proteins in same PDB: d2vmfa4, d2vmfa5, d2vmfb4, d2vmfb5, d2vmfb6 automated match to d2je8a2 complexed with br, cl, edo, mvl |
PDB Entry: 2vmf (more details), 2.1 Å
SCOPe Domain Sequences for d2vmfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vmfb2 b.1.4.0 (B:784-864) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits prikkgeelpvnikhiretyk
Timeline for d2vmfb2: