| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
| Family c.1.8.3: beta-glycanases [51487] (26 proteins) consist of a number of sequence families |
| Protein Five-domain beta-mannosidase, domain 3 [159385] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [159386] (9 PDB entries) Uniprot Q8AAK6 330-678! Uniprot Q8AAK6 331-678 |
| Domain d2vmfa5: 2vmf A:331-678 [153320] Other proteins in same PDB: d2vmfa1, d2vmfa2, d2vmfa3, d2vmfa4, d2vmfb1, d2vmfb2, d2vmfb3, d2vmfb4 automatically matched to 2JE8 A:331-678 complexed with br, cl, edo, mvl |
PDB Entry: 2vmf (more details), 2.1 Å
SCOP Domain Sequences for d2vmfa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vmfa5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]}
rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn
mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn
haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv
hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf
aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle
ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2vmfa5: