| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries) |
| Domain d2vmfa2: 2vmf A:784-864 [153317] Other proteins in same PDB: d2vmfa4, d2vmfa5, d2vmfb4, d2vmfb5, d2vmfb6 automated match to d2je8a2 complexed with br, cl, edo, mvl |
PDB Entry: 2vmf (more details), 2.1 Å
SCOPe Domain Sequences for d2vmfa2:
Sequence, based on SEQRES records: (download)
>d2vmfa2 b.1.4.0 (A:784-864) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits
prikkgeelpvnikhiretyk
>d2vmfa2 b.1.4.0 (A:784-864) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits
prikkgelpvnikhiretyk
Timeline for d2vmfa2: