Lineage for d2vmfa1 (2vmf A:220-330)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936216Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 936217Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 936501Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species)
    truncated domain 5 lacks the last strand
  7. 936502Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries)
    Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864
  8. 936539Domain d2vmfa1: 2vmf A:220-330 [153316]
    Other proteins in same PDB: d2vmfa4, d2vmfa5, d2vmfb4, d2vmfb5
    automatically matched to 2JE8 A:220-330
    complexed with br, cl, edo, mvl

Details for d2vmfa1

PDB Entry: 2vmf (more details), 2.1 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vmfa1:

Sequence, based on SEQRES records: (download)

>d2vmfa1 b.1.4.1 (A:220-330) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq
pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl

Sequence, based on observed residues (ATOM records): (download)

>d2vmfa1 b.1.4.1 (A:220-330) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq
pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgrivaeqshrigl

SCOPe Domain Coordinates for d2vmfa1:

Click to download the PDB-style file with coordinates for d2vmfa1.
(The format of our PDB-style files is described here.)

Timeline for d2vmfa1: