Lineage for d2vlya_ (2vly A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474672Protein Myoglobin [46469] (9 species)
  7. 1474677Species Horse (Equus caballus) [TaxId:9796] [46474] (65 PDB entries)
  8. 1474705Domain d2vlya_: 2vly A: [153309]
    automated match to d1azia_
    complexed with gol, hem, oxy, peo, so4

Details for d2vlya_

PDB Entry: 2vly (more details), 1.6 Å

PDB Description: crystal structure of myoglobin compound iii (radiation-induced)
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2vlya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlya_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOPe Domain Coordinates for d2vlya_:

Click to download the PDB-style file with coordinates for d2vlya_.
(The format of our PDB-style files is described here.)

Timeline for d2vlya_: