SCOP 1.75: Domain d2vlya1: 2vly A:1-152

Lineage for d2vlya1 (2vly A:1-152)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (45 PDB entries)

8. Domain d2vlya1: 2vly A:1-152 [153309]
   automatically matched to d1azia_
   complexed with gol, hem, oxy, peo, so4

Details for d2vlya1

PDB Entry: 2vly, 1.6 Å

PDB Description: crystal structure of myoglobin compound iii (radiation-induced)

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2vlya1:

Sequence; same for both SEQRES and ATOM records:

>d2vlya1 a.1.1.2 (A:1-152) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d2vlya1:

• d2vlya1 is new in SCOP 1.75
  
• d2vlya1 is called d2vlya_ in SCOPe 2.01
  
• d2vlya1 appears in the current release, SCOPe 2.08, called d2vlya_